SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG2406_internal:A_BomoMSG_c10883_g1_i1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		insulin_receptor_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000187 P obsolete activation of MAPK activity
GO:0001933 P negative regulation of protein phosphorylation
GO:0001934 P positive regulation of protein phosphorylation
GO:0003007 P heart morphogenesis
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0004716 F obsolete signal transducer, downstream of receptor, with protein tyrosine kinase activity
GO:0005009 F insulin-activated receptor activity
GO:0005159 F insulin-like growth factor receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005525 F GTP binding
GO:0005634 C nucleus
GO:0005768 C endosome
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005899 C insulin receptor complex
GO:0005901 C caveola
GO:0005975 P carbohydrate metabolic process
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0008284 P positive regulation of cell population proliferation
GO:0008286 P insulin receptor signaling pathway
GO:0008544 P epidermis development
GO:0008584 P male gonad development
GO:0009725 P response to hormone
GO:0009887 P animal organ morphogenesis
GO:0010008 C endosome membrane
GO:0010042 P response to manganese ion
GO:0010310 P regulation of hydrogen peroxide metabolic process
GO:0010560 P positive regulation of glycoprotein biosynthetic process
GO:0010629 P negative regulation of gene expression
GO:0014823 P response to activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019087 P transformation of host cell by virus
GO:0019901 F protein kinase binding
GO:0019903 F protein phosphatase binding
GO:0019904 F protein domain specific binding
GO:0023014 P signal transduction
GO:0030238 P male sex determination
GO:0030325 P adrenal gland development
GO:0030335 P positive regulation of cell migration
GO:0031017 P exocrine pancreas development
GO:0031405 F lipoic acid binding
GO:0031667 P response to nutrient levels
GO:0031994 F insulin-like growth factor I binding
GO:0031995 F insulin-like growth factor II binding
GO:0032147 P activation of protein kinase activity
GO:0032148 P activation of protein kinase B activity
GO:0032355 P response to estradiol
GO:0032403 F protein-containing complex binding
GO:0032410 P negative regulation of transporter activity
GO:0032868 P response to insulin
GO:0032869 P cellular response to insulin stimulus
GO:0033280 P response to vitamin D
GO:0033574 P response to testosterone
GO:0034612 P response to tumor necrosis factor
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0042593 P glucose homeostasis
GO:0043231 C intracellular membrane-bounded organelle
GO:0043235 C receptor complex
GO:0043410 P positive regulation of MAPK cascade
GO:0043423 F 3-phosphoinositide-dependent protein kinase binding
GO:0043548 F phosphatidylinositol 3-kinase binding
GO:0043559 F insulin binding
GO:0043560 F insulin receptor substrate binding
GO:0045202 C synapse
GO:0045429 P positive regulation of nitric oxide biosynthetic process
GO:0045444 P fat cell differentiation
GO:0045471 P response to ethanol
GO:0045725 P positive regulation of glycogen biosynthetic process
GO:0045740 P positive regulation of DNA replication
GO:0045821 P positive regulation of glycolytic process
GO:0045840 P positive regulation of mitotic nuclear division
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045995 P regulation of embryonic development
GO:0046326 P positive regulation of glucose import
GO:0046777 P protein autophosphorylation
GO:0048639 P positive regulation of developmental growth
GO:0051290 P protein heterotetramerization
GO:0051384 P response to glucocorticoid
GO:0051425 F PTB domain binding
GO:0051446 P positive regulation of meiotic cell cycle
GO:0051897 P positive regulation of protein kinase B signaling
GO:0060267 P positive regulation of respiratory burst
GO:0070062 C extracellular exosome
GO:0071363 P cellular response to growth factor stimulus
GO:2000194 P regulation of female gonad development
RNA-seq EntryA_BomoMSG_c10883_g1_i1
Sequence
(Amino Acid)
LESALGEIREIHGCLQVTRSYPLVSLMFLKKLRKIIANPSEDKGEALHIINNENLELLWD
WSTYGPIEIIGSCYIHSNPKLCYTQLMPLMNMSYPKTNFTELEVSQDSNGYQ
(36 a.a.)

- SilkBase 1999-2023 -