SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG2376_5prime_partial:A_BomoMSG_c10807_g1_i2
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)
ATP-binding_cassette_sub-family_D_member_2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0005324 F long-chain fatty acid transporter activity
GO:0005325 F long-chain fatty acid transporter activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005777 C peroxisome
GO:0005778 C peroxisomal membrane
GO:0005779 C integral component of peroxisomal membrane
GO:0006635 P fatty acid beta-oxidation
GO:0006810 P transport
GO:0007031 P peroxisome organization
GO:0015910 P long-chain fatty acid import into peroxisome
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016887 F ATP hydrolysis activity
GO:0019899 F enzyme binding
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0042758 P long-chain fatty acid catabolic process
GO:0042760 P very long-chain fatty acid catabolic process
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0048471 C perinuclear region of cytoplasm
GO:0055085 P transmembrane transport
RNA-seq EntryA_BomoMSG_c10807_g1_i2
Sequence
(Amino Acid)
LRAVRDWRATLSGGEKQRLAMARMFYHRPVYALLDECTSAVSMETEVVMYEEAVKEGITL
LSITHRPSVWKYHTHVLEFDGAGNWSFRKLDKESAVSSPAINSAATSTPAEPPAEH
*(38 a.a.)

- SilkBase 1999-2023 -