SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG2350_internal:A_BomoMSG_c10750_g1_i1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)		uncharacterized_protein_LOC101740358_isoform_X2_[Bombyx_mori]
Ontology
GO:0001530 F lipopolysaccharide binding
GO:0001948 F protein binding
GO:0002576 P platelet degranulation
GO:0002687 P positive regulation of leukocyte migration
GO:0002691 P regulation of cellular extravasation
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006954 P inflammatory response
GO:0007155 P cell adhesion
GO:0007157 P heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0007159 P leukocyte cell-cell adhesion
GO:0008201 F heparin binding
GO:0009897 C external side of plasma membrane
GO:0010572 P positive regulation of platelet activation
GO:0014068 P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0014070 P response to organic cyclic compound
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016337 P cell-cell adhesion
GO:0030246 F carbohydrate binding
GO:0031088 C platelet dense granule membrane
GO:0031092 C platelet alpha granule membrane
GO:0032496 P response to lipopolysaccharide
GO:0033623 P regulation of integrin activation
GO:0033691 F sialic acid binding
GO:0035584 P calcium-mediated signaling using intracellular calcium source
GO:0042806 F fucose binding
GO:0043208 F glycosphingolipid binding
GO:0045785 P positive regulation of cell adhesion
GO:0048306 F calcium-dependent protein binding
GO:0050829 P defense response to Gram-negative bacterium
GO:0050900 P leukocyte migration
GO:0050901 P leukocyte tethering or rolling
GO:0070492 F oligosaccharide binding
RNA-seq EntryA_BomoMSG_c10750_g1_i1
Sequence
(Amino Acid)
APTIVRGFRTMSVMRADGNIAFTSAIRIQYTNDLTDVFKDYTNPDGTAVEFRILEPTLSV
LNLPVPIEAQYVKFKIQDYVGAPCLKLEVMGCARLDCLDINECSENNGGCEQKCLNTPGN
FSCACNLGFELYSSNGTAGFSIELSETGERDGDTYQRNKSCVPVMCPPLAPPENGQLLST
KKSYHFGDTVHFQCDFGYVMSGFSTLQCTSSGTWNGTAPECQYARCVTLSDD
(76 a.a.)

- SilkBase 1999-2023 -