SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG2320_internal:A_BomoMSG_c10642_g1_i2
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)
calcium-independent_phospholipase_A2-gamma_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0001516 P prostaglandin biosynthetic process
GO:0004622 F lysophospholipase activity
GO:0004623 F phospholipase A2 activity
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005777 C peroxisome
GO:0005778 C peroxisomal membrane
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0008152 P metabolic process
GO:0008219 P cell death
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016042 P lipid catabolic process
GO:0016787 F hydrolase activity
GO:0019369 P arachidonic acid metabolic process
GO:0034638 P phosphatidylcholine catabolic process
GO:0036151 P phosphatidylcholine acyl-chain remodeling
GO:0036152 P phosphatidylethanolamine acyl-chain remodeling
GO:0043651 P linoleic acid metabolic process
GO:0046338 P phosphatidylethanolamine catabolic process
GO:0047499 F calcium-independent phospholipase A2 activity
GO:0048471 C perinuclear region of cytoplasm
GO:0050482 P arachidonic acid secretion
RNA-seq EntryA_BomoMSG_c10642_g1_i2
Sequence
(Amino Acid)
ESFLQGLKLKKDLHFGKLSEPSWKSNKPTVTKTSIHSRTAYVISAIVTAETSECLMKRTE
HFIDHLTQYPEARDYAIKALALVGYTGPTKGPGPNILSLDGGGIRGLIAIEILKHLEKIT
GRKVHELFDYIIGEIGRA
(45 a.a.)

- SilkBase 1999-2023 -