SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG2310_3prime_partial:A_BomoMSG_c10593_g1_i1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		E3_ubiquitin-protein_ligase_MIB1_[Bombyx_mori]
Ontology
GO:0000209 P protein polyubiquitination
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005938 C cell cortex
GO:0006897 P endocytosis
GO:0007219 P Notch signaling pathway
GO:0007423 P sensory organ development
GO:0008104 P protein localization
GO:0008270 F zinc ion binding
GO:0008587 P imaginal disc-derived wing margin morphogenesis
GO:0008593 P regulation of Notch signaling pathway
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0045179 C apical cortex
GO:0045747 P positive regulation of Notch signaling pathway
GO:0045807 P positive regulation of endocytosis
GO:0046331 P lateral inhibition
GO:0046872 F metal ion binding
GO:0048749 P compound eye development
GO:0061630 F ubiquitin protein ligase activity
RNA-seq EntryA_BomoMSG_c10593_g1_i1
Sequence
(Amino Acid)
MESNISVSSTSSRPTRFMMEGVGARVIRGPDWKWGKQDGGEGHLGTVRNFESPEEVVVVW
DNGTAANYRCSGAYDLRILDSAPTGVKHEGTMCDTCRQQPIFGIRWKCAECSNYDLCSVC
YHGDKHNLRHRFYRISAPGAQRCLVEPRRKSKKQAVRGIFPGARVVRG
(55 a.a.)

- SilkBase 1999-2023 -