Name | O_BomoMSG2274_internal:A_BomoMSG_c10471_g1_i1 |
Scaffold_id | Bomo_Chr8 |
NCBI non-redundant (nr) | uncharacterized_protein_LOC101743016_[Bombyx_mori] |
Ontology |
GO:0005515 |
F |
protein binding |
GO:0005737 |
C |
cytoplasm |
GO:0005764 |
C |
lysosome |
GO:0006605 |
P |
protein targeting |
GO:0006996 |
P |
organelle organization |
GO:0007040 |
P |
lysosome organization |
GO:0007596 |
P |
blood coagulation |
GO:0007599 |
P |
hemostasis |
GO:0016020 |
C |
membrane |
GO:0016023 |
C |
cytoplasmic vesicle |
GO:0030318 |
P |
melanocyte differentiation |
GO:0031085 |
C |
BLOC-3 complex |
GO:0042470 |
C |
melanosome |
GO:0042803 |
F |
protein homodimerization activity |
GO:0042827 |
C |
platelet dense granule |
GO:0046983 |
F |
protein dimerization activity |
GO:0048075 |
P |
positive regulation of eye pigmentation |
GO:0050821 |
P |
protein stabilization |
GO:1903955 |
P |
positive regulation of protein targeting to mitochondrion |
|
RNA-seq Entry | A_BomoMSG_c10471_g1_i1 |
Sequence (Amino Acid) | PMLSLPKSATSTYMESMQILEHCRKSTGVLGGVILYNNKIIATQLPPGLTSYLTVVDPYR
IKSPAETLETEAPLPLGAQLLVVYVRRKLYDNLKRQTEKLQEFYQN
(34 a.a.) |