| Name | O_BomoMSG2274_internal:A_BomoMSG_c10471_g1_i1 |
| Scaffold_id | Bomo_Chr8 |
NCBI non-redundant (nr) | uncharacterized_protein_LOC101743016_[Bombyx_mori] |
| Ontology |
| GO:0005515 |
F |
protein binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005764 |
C |
lysosome |
| GO:0006605 |
P |
protein targeting |
| GO:0006996 |
P |
organelle organization |
| GO:0007040 |
P |
lysosome organization |
| GO:0007596 |
P |
blood coagulation |
| GO:0007599 |
P |
hemostasis |
| GO:0016020 |
C |
membrane |
| GO:0016023 |
C |
cytoplasmic vesicle |
| GO:0030318 |
P |
melanocyte differentiation |
| GO:0031085 |
C |
BLOC-3 complex |
| GO:0042470 |
C |
melanosome |
| GO:0042803 |
F |
protein homodimerization activity |
| GO:0042827 |
C |
platelet dense granule |
| GO:0046983 |
F |
protein dimerization activity |
| GO:0048075 |
P |
positive regulation of eye pigmentation |
| GO:0050821 |
P |
protein stabilization |
| GO:1903955 |
P |
positive regulation of protein targeting to mitochondrion |
|
| RNA-seq Entry | A_BomoMSG_c10471_g1_i1 |
Sequence (Amino Acid) | PMLSLPKSATSTYMESMQILEHCRKSTGVLGGVILYNNKIIATQLPPGLTSYLTVVDPYR
IKSPAETLETEAPLPLGAQLLVVYVRRKLYDNLKRQTEKLQEFYQN
(34 a.a.) |