| Name | O_BomoMSG2249_5prime_partial:A_BomoMSG_c10410_g1_i1 |
| Scaffold_id | Bomo_Chr3 |
| NCBI non-redundant (nr) | translation_initiation_factor_eIF-2B_subunit_epsilon_isoform_X2_[Bombyx_mori] |
| Ontology | |
| RNA-seq Entry | A_BomoMSG_c10410_g1_i1 |
| Sequence (Amino Acid) | LAAQCIFSIILVKLCFCILRDLYFVFVCFDFVFVCLRLCLLCCCGFLKCISNLYAEIWDH FGKCLGAEKIAMCNYCKKNQFKNIEPAHRRGGKFVKSFSH *(32 a.a.) |
- SilkBase 1999-2023 -