SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG220_complete:A_BomoMSG_c1039_g1_i1
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)
RNA_binding_motif_protein_Y14_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000184 P nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000226 P microtubule cytoskeleton organization
GO:0000335 P negative regulation of transposition, DNA-mediated
GO:0000381 P regulation of alternative mRNA splicing, via spliceosome
GO:0000398 P mRNA splicing, via spliceosome
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006396 P RNA processing
GO:0006397 P mRNA processing
GO:0006406 P mRNA export from nucleus
GO:0006810 P transport
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007294 P germarium-derived oocyte fate determination
GO:0007310 P oocyte dorsal/ventral axis specification
GO:0007312 P oocyte nucleus migration involved in oocyte dorsal/ventral axis specification
GO:0007314 P oocyte anterior/posterior axis specification
GO:0007317 P regulation of pole plasm oskar mRNA localization
GO:0008380 P RNA splicing
GO:0035145 C exon-exon junction complex
GO:0045451 P pole plasm oskar mRNA localization
GO:0046595 P establishment of pole plasm mRNA localization
GO:0051028 P mRNA transport
GO:0071013 C catalytic step 2 spliceosome
RNA-seq EntryA_BomoMSG_c1039_g1_i1
Sequence
(Amino Acid)
MADVLDIENSEEFEVDEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGRYDSLA
PEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGY
ALVEYETYKQAASAREALDGADILGQAISVDWCFVKGPTKSHKKRR
*(54 a.a.)

- SilkBase 1999-2023 -