SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG218_internal:A_BomoMSG_c1023_g1_i1
Scaffold_idBomo_Chr26
NCBI non-redundant
(nr)		uncharacterized_protein_LOC101738149_[Bombyx_mori]
Ontology
GO:0001525 P angiogenesis
GO:0001669 C acrosomal vesicle
GO:0001953 P negative regulation of cell-matrix adhesion
GO:0004222 F metalloendopeptidase activity
GO:0005178 F integrin binding
GO:0005515 F protein binding
GO:0005912 C adherens junction
GO:0006508 P proteolysis
GO:0007155 P cell adhesion
GO:0007229 P integrin-mediated signaling pathway
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0008270 F zinc ion binding
GO:0008584 P male gonad development
GO:0009986 C cell surface
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0017124 F SH3 domain binding
GO:0030054 C cell junction
GO:0030308 P negative regulation of cell growth
GO:0030336 P negative regulation of cell migration
GO:0030574 P collagen catabolic process
GO:0031410 C cytoplasmic vesicle
GO:0042246 P tissue regeneration
GO:0042995 C cell projection
GO:0045087 P innate immune response
GO:0046872 F metal ion binding
GO:0060317 P cardiac epithelial to mesenchymal transition
GO:0070062 C extracellular exosome
GO:0070528 P protein kinase C signaling
GO:1900121 P negative regulation of receptor binding
RNA-seq EntryA_BomoMSG_c1023_g1_i1
Sequence
(Amino Acid)
LKHFLHYRRTTLLREVPNDNAHLLTRQAFKDGVVGKALKGPICTYEFSGGVATNHSEVLG
LVATTIAHEMGHNFGIEHDTEEHCECPDEKCIMSPSSTSVIPVRWSSCSLKSLALSFERG
MDYCLRNKPRRLFQSPTCGNGFIEPG
(47 a.a.)

- SilkBase 1999-2023 -