SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG21784_internal:A_BomoMSG_c26988_g2_i2
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_protein_tiptop_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007380 P specification of segmental identity, head
GO:0007384 P specification of segmental identity, thorax
GO:0007385 P specification of segmental identity, abdomen
GO:0007431 P salivary gland development
GO:0007450 P dorsal/ventral pattern formation, imaginal disc
GO:0007473 P wing disc proximal/distal pattern formation
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007479 P leg disc proximal/distal pattern formation
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0007494 P midgut development
GO:0008258 P head involution
GO:0010468 P regulation of gene expression
GO:0010906 P regulation of glucose metabolic process
GO:0016055 P Wnt signaling pathway
GO:0035214 P eye-antennal disc development
GO:0035292 P specification of segmental identity, trunk
GO:0045705 P negative regulation of salivary gland boundary specification
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0048730 P epidermis morphogenesis
GO:0048749 P compound eye development
GO:0061330 P Malpighian tubule stellate cell differentiation
RNA-seq EntryA_BomoMSG_c26988_g2_i2
Sequence
(Amino Acid)
CSSDLITPTSRDGRKSINEELPSPGSAHHRSPSSVNDSSPCSKDPNVNMDKSSSPSVLNA
IEQLIEKSFDTRSRHSVPGMPGGASHAPIGSSILKRLGIDESVDYTKPLVDAQTMNMLRN
YHQQSGYGRRERSGSESSSMSERGGSRVESLTPDRKLDSYHMTPRTTPDTRGSQTPASED
RHEIRIKKEVDEEDQRENGVDLSNQPVRVKTEMEEEEEPLRPRSSTEEDIKPVVPKRESE
GPSPAASPRSPSSDRSGNTPGADRKPASSLGALSSMFDNLAGGGPSNEPSSSRRGGSHPL
AALQKLCDKTENTPEIGRAS
(105 a.a.)

- SilkBase 1999-2023 -