SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG2174_internal:A_BomoMSG_c10269_g1_i1
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)		G-protein_coupled_receptor_Mth2_[Bombyx_mori]
Ontology
GO:0000302 P response to reactive oxygen species
GO:0004871 F obsolete signal transducer activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0005515 F protein binding
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006836 P neurotransmitter transport
GO:0006887 P exocytosis
GO:0006950 P response to stress
GO:0006979 P response to oxidative stress
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007568 P aging
GO:0008340 P determination of adult lifespan
GO:0008528 F G protein-coupled peptide receptor activity
GO:0009408 P response to heat
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016079 P synaptic vesicle exocytosis
GO:0042277 F peptide binding
GO:0042594 P response to starvation
GO:0045202 C synapse
GO:0098793 C presynapse
GO:1901562 P response to paraquat
RNA-seq EntryA_BomoMSG_c10269_g1_i1
Sequence
(Amino Acid)
DLFGKSIISYCGSMAIALALLAIIKLMAYSDMSWCAVRGFLAYFFLISSFFWSNAISIQI
LLCSRAPALFSAKSSFLWYSLYAWGCPAVLTICMAIVKFHPG
(33 a.a.)

- SilkBase 1999-2023 -