SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG21456_internal:A_BomoMSG_c26922_g1_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		E3_ubiquitin-protein_ligase_UHRF1_isoform_X2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000790 C chromatin
GO:0000791 C euchromatin
GO:0000792 C heterochromatin
GO:0003677 F DNA binding
GO:0004842 F ubiquitin-protein transferase activity
GO:0005634 C nucleus
GO:0005657 C replication fork
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007049 P cell cycle
GO:0008270 F zinc ion binding
GO:0010216 P maintenance of DNA methylation
GO:0016567 P protein ubiquitination
GO:0016568 P chromatin organization
GO:0016574 P histone ubiquitination
GO:0016874 F ligase activity
GO:0035064 F methylated histone binding
GO:0042393 F histone binding
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0044729 F hemi-methylated DNA-binding
GO:0046872 F metal ion binding
GO:0051865 P protein autoubiquitination
RNA-seq EntryA_BomoMSG_c26922_g1_i1
Sequence
(Amino Acid)
VCSSDLSPPAKKRKTASENKRKGKSSKTKSTTSPNGSILEMFSPKRRNSANGMKQVKKSE
SVLTSEERDAIKADTLNSKLWGECLAVCDSWGKKEFVEFVSMQFLCIICQEVAASPVTTP
CLHNFCMACLKLAFKTTGAICPCC
(47 a.a.)

- SilkBase 1999-2023 -