SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG20_internal:A_BomoMSG_c128_g1_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		membrane-bound_transcription_factor_site-1_protease,_partial_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0004175 F endopeptidase activity
GO:0004252 F serine-type endopeptidase activity
GO:0005783 C endoplasmic reticulum
GO:0005788 C endoplasmic reticulum lumen
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005795 C Golgi stack
GO:0006508 P proteolysis
GO:0006629 P lipid metabolic process
GO:0007040 P lysosome organization
GO:0008202 P steroid metabolic process
GO:0008203 P cholesterol metabolic process
GO:0008233 F peptidase activity
GO:0008236 F serine-type peptidase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0031293 P membrane protein intracellular domain proteolysis
GO:0034976 P response to endoplasmic reticulum stress
GO:0036500 P ATF6-mediated unfolded protein response
GO:0042990 P obsolete regulation of transcription factor import into nucleus
RNA-seq EntryA_BomoMSG_c128_g1_i1
Sequence
(Amino Acid)
EKPGAANGKTEVTQPLQVPILGLLQTDGDIHDYSNDTVDKVPKSGRLVVYGDSSCLEGGT
ARNCHWLLLAALQYAIVGHVPPALKEAATPQEKRVRDVHIIPSELPRRAEGGRLHVYSRV
LSPDGSGPRPIPECFSPTPLPSQ
(46 a.a.)

- SilkBase 1999-2023 -