SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG2093_complete:A_BomoMSG_c10037_g1_i1
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)		transcription_factor_jun-D_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000165 P MAPK cascade
GO:0000790 C chromatin
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001736 P establishment of planar polarity
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003713 F transcription coactivator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006909 P phagocytosis
GO:0007254 P JNK cascade
GO:0007391 P dorsal closure
GO:0007464 P R3/R4 cell fate commitment
GO:0007465 P R7 cell fate commitment
GO:0008134 F transcription factor binding
GO:0008348 P negative regulation of antimicrobial humoral response
GO:0009314 P response to radiation
GO:0009612 P response to mechanical stimulus
GO:0010259 P multicellular organism aging
GO:0010941 P regulation of cell death
GO:0032496 P response to lipopolysaccharide
GO:0032870 P cellular response to hormone stimulus
GO:0034097 P response to cytokine
GO:0042060 P wound healing
GO:0042127 P regulation of cell population proliferation
GO:0042493 P response to xenobiotic stimulus
GO:0043565 F sequence-specific DNA binding
GO:0045597 P positive regulation of cell differentiation
GO:0045823 P positive regulation of heart contraction
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046529 P imaginal disc fusion, thorax closure
GO:0046843 P dorsal appendage formation
GO:0046844 P chorion micropyle formation
GO:0046982 F protein heterodimerization activity
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0051591 P response to cAMP
GO:0051726 P regulation of cell cycle
RNA-seq EntryA_BomoMSG_c10037_g1_i1
Sequence
(Amino Acid)
MVRNSGHSMETTFYDEQYPLSGPVENLKRPLTLDVGRGGKRSRIAAPVLSSPDLQMLKLG
SPELEKLIIQNGMVTTATPTPGAPVLFPAVAPTEEQEMYARPFVEALDKLHHGEAVTPLG
RRVYADLDRPLERYPTPIVKDEPQTVPSAASTPPLSPIDMDTQEKIKLERKRQRNRVAAS
KCRRRKLERISKLEEKVKILKGENAELAQMVVKLRDHVHRLKEQVLEHANGGCHIESHF
*(79 a.a.)

- SilkBase 1999-2023 -