SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG2075_internal:A_BomoMSG_c10000_g1_i1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)		protein_borderless_[Bombyx_mori]
Ontology
GO:0003674 F molecular_function
GO:0005515 F protein binding
GO:0005575 C cellular_component
GO:0005887 C integral component of plasma membrane
GO:0007411 P axon guidance
GO:0007414 P axonal defasciculation
GO:0007422 P peripheral nervous system development
GO:0007629 P flight behavior
GO:0007638 P mechanosensory behavior
GO:0008039 P synaptic target recognition
GO:0008344 P adult locomotory behavior
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016199 P axon midline choice point recognition
GO:0019233 P sensory perception of pain
GO:0030537 P larval behavior
GO:0045467 P R7 cell development
GO:0046331 P lateral inhibition
GO:0048814 P regulation of dendrite morphogenesis
GO:0070593 P dendrite self-avoidance
GO:0098609 P cell-cell adhesion
GO:0098632 F cell-cell adhesion mediator activity
RNA-seq EntryA_BomoMSG_c10000_g1_i1
Sequence
(Amino Acid)
PLLRWTRKDGSSLPDGRHSVDEGNLTVVDVAEEDRGVYVCTVSNEAASVSVETELLVENV
PPRAPYNLTAAPSNDSIHLTWVPGHNGLDVDYNVWYRERTVSEWRTM
(34 a.a.)

- SilkBase 1999-2023 -