SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG2055_5prime_partial:A_BomoMSG_c9943_g1_i1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		alpha-crystallin_B_chain_[Bombyx_mori]
Ontology
GO:0001666 P response to hypoxia
GO:0002088 P lens development in camera-type eye
GO:0005212 F structural constituent of eye lens
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006457 P protein folding
GO:0007021 P tubulin complex assembly
GO:0007517 P muscle organ development
GO:0007568 P aging
GO:0008017 F microtubule binding
GO:0008092 F cytoskeletal protein binding
GO:0009986 C cell surface
GO:0010629 P negative regulation of gene expression
GO:0010941 P regulation of cell death
GO:0014069 C postsynaptic density
GO:0015630 C microtubule cytoskeleton
GO:0030018 C Z disc
GO:0030308 P negative regulation of cell growth
GO:0030424 C axon
GO:0031109 P microtubule polymerization or depolymerization
GO:0031430 C M band
GO:0031674 C I band
GO:0032355 P response to estradiol
GO:0032387 P negative regulation of intracellular transport
GO:0032432 C actin filament bundle
GO:0042542 P response to hydrogen peroxide
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043010 P camera-type eye development
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043197 C dendritic spine
GO:0043204 C perikaryon
GO:0043209 C myelin sheath
GO:0043292 C contractile fiber
GO:0045202 C synapse
GO:0046872 F metal ion binding
GO:0051082 F unfolded protein binding
GO:0051260 P protein homooligomerization
GO:0051403 P stress-activated MAPK cascade
GO:0060561 P apoptotic process involved in morphogenesis
GO:0070062 C extracellular exosome
GO:0071480 P cellular response to gamma radiation
GO:0097060 C synaptic membrane
GO:0097512 C cardiac myofibril
GO:2000378 P negative regulation of reactive oxygen species metabolic process
RNA-seq EntryA_BomoMSG_c9943_g1_i1
Sequence
(Amino Acid)
CILEFETRISKKMFSPRLFAVFIAFAGFATVTALPARDKEVIAQPVSITDDQFTFPWLNL
SPFSLFAPLWKLIPTFVDIGPRIYADDDKFKVVVNVKDYKKDNLKVKVKGDFIFVQGSQE
AKEDDHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPI
VETGAPYKKDEPVEKTTVETLDVSTTQEPKTSAPAVVTAAPEPEEKKEPTTPSELDEATE
KDNVIPHGNEVSA
*(83 a.a.)

- SilkBase 1999-2023 -