SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG20476_5prime_partial:A_BomoMSG_c26697_g1_i2
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)		egl_nine_homolog_1_[Bombyx_mori]
Ontology
GO:0001666 P response to hypoxia
GO:0005506 F iron ion binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0016491 F oxidoreductase activity
GO:0016705 F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016706 F 2-oxoglutarate-dependent dioxygenase activity
GO:0018401 P peptidyl-proline hydroxylation to 4-hydroxy-L-proline
GO:0019899 F enzyme binding
GO:0030821 P obsolete negative regulation of cAMP catabolic process
GO:0031418 F L-ascorbic acid binding
GO:0031543 F peptidyl-proline dioxygenase activity
GO:0031545 F peptidyl-proline 4-dioxygenase activity
GO:0032364 P oxygen homeostasis
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0045765 P regulation of angiogenesis
GO:0046872 F metal ion binding
GO:0051213 F dioxygenase activity
GO:0051344 P negative regulation of cyclic-nucleotide phosphodiesterase activity
GO:0055008 P cardiac muscle tissue morphogenesis
GO:0055114 P obsolete oxidation-reduction process
GO:0060347 P heart trabecula formation
GO:0060412 P ventricular septum morphogenesis
GO:0060711 P labyrinthine layer development
GO:0061418 P regulation of transcription from RNA polymerase II promoter in response to hypoxia
GO:0071731 P response to nitric oxide
RNA-seq EntryA_BomoMSG_c26697_g1_i2
Sequence
(Amino Acid)
SSDLVAPFNHMLNSYYMDPSDPFYEICQRVIRDMTQYGVCVLNNFLGKDQGLLVLNEVLK
MYRSGIFTAGQLVSSPGSTEAQTIRSDRITWIDGKEPQCFHIRQLISKVDNIILRANKMA
NNGKMGDFVINGRTKAMVACYPGLGSHYVKHVDNPNKDGRCITAIYYLNLDWDVKRYGGL
LRVFPEGTNQVADIAPIFDRMLFFWSDRRNPHEVQPAYSTRYAITLWYFDAHEREEALRK
YKERGQPSSSK
*(83 a.a.)

- SilkBase 1999-2023 -