SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG20141_internal:A_BomoMSG_c26604_g1_i1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		dynamin-like_120_kDa_protein,_mitochondrial_isoform_X3_[Bombyx_mori]
Ontology
GO:0000002 P mitochondrial genome maintenance
GO:0000166 F nucleotide binding
GO:0001843 P neural tube closure
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005743 C mitochondrial inner membrane
GO:0005758 C mitochondrial intermembrane space
GO:0006915 P apoptotic process
GO:0007005 P mitochondrion organization
GO:0007007 P inner mitochondrial membrane organization
GO:0007601 P visual perception
GO:0008053 P mitochondrial fusion
GO:0008152 P metabolic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0030061 C mitochondrial crista
GO:0030425 C dendrite
GO:0050896 P response to stimulus
GO:0090201 P negative regulation of release of cytochrome c from mitochondria
GO:0090398 P cellular senescence
GO:1902236 P negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:2001243 P negative regulation of intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomoMSG_c26604_g1_i1
Sequence
(Amino Acid)
VTGRSRRDDSIQGIREYEERFFSSSKLFKNGLVTPSQVTTRNLSLAVAECFWRMVRATVE
QQADAFKAMRFNLETEWKNTFPRQRELDRDELFERARAELLDQAAELSAVPAQRWEHALR
DALWDHAAPTVMDRIYLPAAAAAHDDQDQFNTLVD
(50 a.a.)

- SilkBase 1999-2023 -