SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG2003_internal:A_BomoMSG_c9782_g1_i1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)		DNA_polymerase_theta_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003887 F DNA-directed DNA polymerase activity
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0006260 P DNA replication
GO:0006261 P DNA-dependent DNA replication
GO:0007049 P cell cycle
GO:0007275 P multicellular organism development
GO:0009640 P photomorphogenesis
GO:0009933 P meristem structural organization
GO:0010468 P regulation of gene expression
GO:0016787 F hydrolase activity
GO:0051301 P cell division
GO:0071897 P DNA biosynthetic process
GO:1902749 P regulation of cell cycle G2/M phase transition
GO:1990067 P intrachromosomal DNA recombination
GO:2000011 P regulation of adaxial/abaxial pattern formation
RNA-seq EntryA_BomoMSG_c9782_g1_i1
Sequence
(Amino Acid)
LAQESRVKAWAIEMISEKQQNALYESYQNAINVEIKVLKILSNCELHGIVVDKELVSRLL
TDVRDSQDVLQKKAFKICGYHFNFNSSKDVAKVLGIYNGRKTST
(33 a.a.)

- SilkBase 1999-2023 -