SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1999_5prime_partial:A_BomoMSG_c9745_g1_i1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		serine/threonine-protein_kinase_Genghis_Khan_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0006468 P protein phosphorylation
GO:0008039 P synaptic target recognition
GO:0008064 P regulation of actin polymerization or depolymerization
GO:0008154 P actin polymerization or depolymerization
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030424 C axon
GO:0030426 C growth cone
GO:0030833 P regulation of actin filament polymerization
GO:0035556 P intracellular signal transduction
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoMSG_c9745_g1_i1
Sequence
(Amino Acid)
GGGPVGSQAGGGWRNRRSQKLDKMEILTLQSSLHSEIQAKQVVSEELSRTRAELLASQRE
LLETRQRLDSLAHDLKRKEQHTRDLQARLDAPHAAGNSFQRRPRRKKRK
*(35 a.a.)

- SilkBase 1999-2023 -