SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG19946_5prime_partial:A_BomoMSG_c26558_g1_i1
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)		endonuclease_G,_mitochondrial,_partial_[Bombyx_mori]
Ontology
GO:0001701 P in utero embryonic development
GO:0003676 F nucleic acid binding
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0004536 F deoxyribonuclease activity
GO:0005634 C nucleus
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0006308 P DNA catabolic process
GO:0006309 P apoptotic DNA fragmentation
GO:0007568 P aging
GO:0009612 P response to mechanical stimulus
GO:0016787 F hydrolase activity
GO:0032355 P response to estradiol
GO:0034599 P cellular response to oxidative stress
GO:0034612 P response to tumor necrosis factor
GO:0036475 P neuron death in response to oxidative stress
GO:0043065 P positive regulation of apoptotic process
GO:0043204 C perikaryon
GO:0046677 P response to antibiotic
GO:0046872 F metal ion binding
GO:0071277 P cellular response to calcium ion
GO:0071333 P cellular response to glucose stimulus
GO:0071456 P cellular response to hypoxia
GO:1901300 P positive regulation of hydrogen peroxide-mediated programmed cell death
GO:1902512 P positive regulation of apoptotic DNA fragmentation
RNA-seq EntryA_BomoMSG_c26558_g1_i1
Sequence
(Amino Acid)
YIGQCNGKNTTQDCIEVDGKLLTSLPALPVFGTVSAAVPYTESGGSKDTTRVSQIMKYGF
PGLDNIRSYDDYVLSYDRRTRVPHWVFEHLTKAHIAKNDQVDRSKCDFMPDESIHPFFRS
LNSDYKGSGFDRGHMAAAGNHRLAQKHVEQTFYLTNMAPQVGEGFNRHAWNRLEKHVRKL
TKLYDHVYCCTGPLYLPRKESDGKSYVRYQVIGANTVAVPTHFYKVVVGEAPDGTLDMEA
YVMPNQKIPDETPVSSFMVPPETIERAAGLLFFDKIHRSKLSRINGKKV
*(95 a.a.)

- SilkBase 1999-2023 -