SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG19497_3prime_partial:A_BomoMSG_c26449_g1_i4
Scaffold_idBomo_Chr14
NCBI non-redundant
(nr)		hypothetical_protein_KGM_213784_[Danaus_plexippus_plexippus]
Ontology
GO:0000166 F nucleotide binding
GO:0001654 P eye development
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0007224 P smoothened signaling pathway
GO:0008284 P positive regulation of cell population proliferation
GO:0009952 P anterior/posterior pattern specification
GO:0010803 P regulation of tumor necrosis factor-mediated signaling pathway
GO:0010842 P retina layer formation
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016605 C PML body
GO:0016607 C nuclear speck
GO:0016740 F transferase activity
GO:0030182 P neuron differentiation
GO:0034333 P adherens junction assembly
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0045766 P positive regulation of angiogenesis
GO:0048596 P embryonic camera-type eye morphogenesis
GO:0060059 P embryonic retina morphogenesis in camera-type eye
GO:0060216 P definitive hemopoiesis
GO:0060235 P lens induction in camera-type eye
GO:0061072 P iris morphogenesis
GO:0072577 P endothelial cell apoptotic process
GO:0097191 P extrinsic apoptotic signaling pathway
GO:1901796 P regulation of signal transduction by p53 class mediator
RNA-seq EntryA_BomoMSG_c26449_g1_i4
Sequence
(Amino Acid)
MLEQNLYDFLKQNKFSPLPLKYIRPILQQVLTALLKLKQLGLIHADLKPENIMLVEPARQ
PYRVKVIDFGSASHVSKAVCNTYLQSRYYRAPEIILGLAFCEAIDMWSLGCVVAELFLGW
PLYPGSSEYDQIRYISQTQGLPTEHMLNSASKTAKFFYRDVDSTYPFWRLKTPEEHELET
GIKSKEARKYIFNCLDDIGQVNVPTDLEGGQLLAEKADRREFIDLLKRMLTMDQERRITP
GEEIGRAS
(81 a.a.)

- SilkBase 1999-2023 -