SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG18971_5prime_partial:A_BomoMSG_c26304_g1_i5
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
vacuolar_protein_sorting-associated_protein_41_homolog_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005794 C Golgi apparatus
GO:0005798 C Golgi-associated vesicle
GO:0005829 C cytosol
GO:0006623 P protein targeting to vacuole
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006914 P autophagy
GO:0008017 F microtubule binding
GO:0008270 F zinc ion binding
GO:0008333 P endosome to lysosome transport
GO:0010008 C endosome membrane
GO:0015031 P protein transport
GO:0015630 C microtubule cytoskeleton
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0030123 C AP-3 adaptor complex
GO:0030136 C clathrin-coated vesicle
GO:0030897 C HOPS complex
GO:0031410 C cytoplasmic vesicle
GO:0031902 C late endosome membrane
GO:0033263 C CORVET complex
GO:0034058 P endosomal vesicle fusion
GO:0035542 P regulation of SNARE complex assembly
GO:0042144 P vacuole fusion, non-autophagic
GO:0042802 F identical protein binding
GO:0043621 F protein self-association
GO:0045055 P regulated exocytosis
GO:0046872 F metal ion binding
GO:0048193 P Golgi vesicle transport
GO:0051020 F GTPase binding
GO:0071439 C clathrin complex
GO:1902774 P late endosome to lysosome transport
RNA-seq EntryA_BomoMSG_c26304_g1_i5
Sequence
(Amino Acid)
ALPILLIQNIKPGCEIKDLKECLAKMMCDYHLQLSVQEACKVITLRNYFDLHEKQVMAQQ
RGISVTDDFLCCVCHGRIIIRDMSNASDLLVYNCRHSFHAGCLPEGDQCAVCNAVRM
*(38 a.a.)

- SilkBase 1999-2023 -