SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG18953_internal:A_BomoMSG_c26297_g2_i1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
double-stranded_RNA-binding_protein_Staufen_homolog_2_isoform_X1_[Bombyx_mori]
Ontology
GO:0000932 C P-body
GO:0003723 F RNA binding
GO:0003725 F double-stranded RNA binding
GO:0003729 F mRNA binding
GO:0003730 F mRNA 3'-UTR binding
GO:0005737 C cytoplasm
GO:0005875 C microtubule associated complex
GO:0005938 C cell cortex
GO:0006403 P RNA localization
GO:0007017 P microtubule-based process
GO:0007275 P multicellular organism development
GO:0007315 P pole plasm assembly
GO:0007316 P pole plasm RNA localization
GO:0007317 P regulation of pole plasm oskar mRNA localization
GO:0007318 P pole plasm protein localization
GO:0007400 P neuroblast fate determination
GO:0007616 P long-term memory
GO:0008017 F microtubule binding
GO:0008104 P protein localization
GO:0008298 P intracellular mRNA localization
GO:0008595 P anterior/posterior axis specification, embryo
GO:0009925 C basal plasma membrane
GO:0010606 P positive regulation of cytoplasmic mRNA processing body assembly
GO:0016324 C apical plasma membrane
GO:0019094 P pole plasm mRNA localization
GO:0035418 P protein localization to synapse
GO:0045167 P asymmetric protein localization involved in cell fate determination
GO:0045177 C apical part of cell
GO:0045179 C apical cortex
GO:0045180 C basal cortex
GO:0045450 P bicoid mRNA localization
GO:0045451 P pole plasm oskar mRNA localization
GO:0045887 P positive regulation of synaptic assembly at neuromuscular junction
GO:0046011 P regulation of oskar mRNA translation
GO:0046012 P positive regulation of oskar mRNA translation
GO:0048477 P oogenesis
GO:0055059 P asymmetric neuroblast division
GO:0060293 C germ plasm
GO:0071212 C subsynaptic reticulum
RNA-seq EntryA_BomoMSG_c26297_g2_i1
Sequence
(Amino Acid)
APAAGDGEARAPAAAANSKEKTPMCLVNELARYNKIKHQYRLTSETGPAHKKVFTVTLRL
GEAEEYTAEGSSIKRAQHAAAGAALAGTAYPPPPPRPAPPLD
(33 a.a.)

- SilkBase 1999-2023 -