SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG18715_internal:A_BomoMSG_c26216_g1_i3
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
CCR4-NOT_transcription_complex_subunit_1_isoform_X4_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000288 P nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0000932 C P-body
GO:0001829 P trophectodermal cell differentiation
GO:0004535 F poly(A)-specific ribonuclease activity
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005778 C peroxisomal membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006417 P regulation of translation
GO:0007275 P multicellular organism development
GO:0010606 P positive regulation of cytoplasmic mRNA processing body assembly
GO:0016020 C membrane
GO:0017148 P negative regulation of translation
GO:0019904 F protein domain specific binding
GO:0030014 C CCR4-NOT complex
GO:0030015 C CCR4-NOT core complex
GO:0030331 F estrogen receptor binding
GO:0031047 P gene silencing by RNA
GO:0032947 F molecular adaptor activity
GO:0033147 P negative regulation of intracellular estrogen receptor signaling pathway
GO:0035195 P gene silencing by miRNA
GO:0042974 F retinoic acid receptor binding
GO:0043231 C intracellular membrane-bounded organelle
GO:0044822 F RNA binding
GO:0048387 P negative regulation of retinoic acid receptor signaling pathway
GO:0060213 P positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0061014 P positive regulation of mRNA catabolic process
GO:0070016 F armadillo repeat domain binding
GO:0090503 P RNA phosphodiester bond hydrolysis, exonucleolytic
GO:1900153 P positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:2000036 P regulation of stem cell population maintenance
RNA-seq EntryA_BomoMSG_c26216_g1_i3
Sequence
(Amino Acid)
IGRASLAAVTKDLFLKRLRSDFPREVVPIVLAPLIYPDDTQTPLEEMTSADDMAAAMMEN
SLPDIIRDMGHAFTTSVEDCKNNMINFGAREPTAIDVARIIAVMVRYHSNQQDGPQIQTP
GNFWMSHEAKKEPAAHPHSEWNAEVFVQTLKELASNLNWKEVILQLDHPEFFVPDRTGLS
LLFTILRLGLQSAGYPANIFPVEYLCRRWTNLEGQMSLISHILKHSDVFCFADHPFHPVS
IDILKSPPETDNKEVGTWRCLYLV
(87 a.a.)

- SilkBase 1999-2023 -