SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG18554_complete:A_BomoMSG_c26167_g1_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		syntaxin_6_isoform_X1_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000149 F SNARE binding
GO:0005484 F SNAP receptor activity
GO:0005515 F protein binding
GO:0005769 C early endosome
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006906 P vesicle fusion
GO:0007032 P endosome organization
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016192 P vesicle-mediated transport
GO:0019905 F syntaxin binding
GO:0031201 C SNARE complex
GO:0032588 C trans-Golgi network membrane
GO:0032880 P regulation of protein localization
GO:0042147 P retrograde transport, endosome to Golgi
GO:0043195 C terminal bouton
GO:0045335 C phagocytic vesicle
GO:0048193 P Golgi vesicle transport
GO:0048278 P vesicle docking
GO:0048471 C perinuclear region of cytoplasm
GO:0090161 P Golgi ribbon formation
GO:1903827 P regulation of protein localization
RNA-seq EntryA_BomoMSG_c26167_g1_i1
Sequence
(Amino Acid)
MKSKMSLNRNRDNDGTAREPLLGDDSPMNFGNNWTSTPKYTKYSKLANQTDSPNRFDIYD
NDILSMQDKLLGNQNEQLQVISETVGSLKTVSKQIGLELDEQAVMLDDLNTDLENTDSKL
DSTLKKVAKLLHMNNDRRQWFAIMILVGLIFLVLLLFIIL
*(52 a.a.)

- SilkBase 1999-2023 -