SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG18551_3prime_partial:A_BomoMSG_c26165_g1_i1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)		islet_cell_autoantigen_1_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0003674 F molecular_function
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005795 C Golgi stack
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006836 P neurotransmitter transport
GO:0016020 C membrane
GO:0019904 F protein domain specific binding
GO:0030054 C cell junction
GO:0030425 C dendrite
GO:0030658 C transport vesicle membrane
GO:0030667 C secretory granule membrane
GO:0030672 C synaptic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0043496 P regulation of protein homodimerization activity
GO:0045202 C synapse
GO:0048471 C perinuclear region of cytoplasm
GO:0050796 P regulation of insulin secretion
RNA-seq EntryA_BomoMSG_c26165_g1_i1
Sequence
(Amino Acid)
MMQHQYWVTKKTVLKKLGTKEDECIVSSDAELDAKLELFRSISDSCLQLQRVLDQYQERI
CILAQEENALGKFLRDSGKNADASGKHMISAGKAISYCGQQR
(33 a.a.)

- SilkBase 1999-2023 -