SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG18348_5prime_partial:A_BomoMSG_c26108_g1_i4
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)
tankyrase_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000209 P protein polyubiquitination
GO:0000242 C pericentriolar material
GO:0000775 C chromosome, centromeric region
GO:0000781 C chromosome, telomeric region
GO:0000784 C chromosome, telomeric region
GO:0000922 C spindle pole
GO:0003950 F NAD+ ADP-ribosyltransferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005643 C nuclear pore
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0006471 P protein ADP-ribosylation
GO:0006810 P transport
GO:0007049 P cell cycle
GO:0007052 P mitotic spindle organization
GO:0007067 P mitotic cell cycle
GO:0008270 F zinc ion binding
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016055 P Wnt signaling pathway
GO:0016740 F transferase activity
GO:0016757 F glycosyltransferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0018107 P peptidyl-threonine phosphorylation
GO:0031965 C nuclear membrane
GO:0032210 P regulation of telomere maintenance via telomerase
GO:0032212 P positive regulation of telomere maintenance via telomerase
GO:0042393 F histone binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0051028 P mRNA transport
GO:0051225 P spindle assembly
GO:0051301 P cell division
GO:0051973 P positive regulation of telomerase activity
GO:0070198 P protein localization to chromosome, telomeric region
GO:0070212 P protein poly-ADP-ribosylation
GO:0070213 P protein auto-ADP-ribosylation
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:1904355 P positive regulation of telomere capping
GO:1904357 P negative regulation of telomere maintenance via telomere lengthening
GO:1904743 P negative regulation of telomeric DNA binding
GO:1904908 P negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
RNA-seq EntryA_BomoMSG_c26108_g1_i4
Sequence
(Amino Acid)
VLFRSAEEAGGDNERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGIYFAEHSSKSNQYV
YGFGGGSGCPAHKDRSCYLCHRQMLLCRVTLGRGFQLLSAMKMAHAPPGHHSVAGRPSQG
GLCFPEYVVYRGEQAYPEYLITYQIVSSESGPGEV
*(51 a.a.)

- SilkBase 1999-2023 -