SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG18339_5prime_partial:A_BomoMSG_c26108_g1_i1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		tankyrase_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000209 P protein polyubiquitination
GO:0000242 C pericentriolar material
GO:0000723 P telomere maintenance
GO:0000781 C chromosome, telomeric region
GO:0003950 F NAD+ ADP-ribosyltransferase activity
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0006471 P protein ADP-ribosylation
GO:0016020 C membrane
GO:0016055 P Wnt signaling pathway
GO:0016740 F transferase activity
GO:0016757 F glycosyltransferase activity
GO:0019899 F enzyme binding
GO:0035264 P multicellular organism growth
GO:0040014 P regulation of multicellular organism growth
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0070198 P protein localization to chromosome, telomeric region
GO:0070213 P protein auto-ADP-ribosylation
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:1904355 P positive regulation of telomere capping
GO:1904357 P negative regulation of telomere maintenance via telomere lengthening
RNA-seq EntryA_BomoMSG_c26108_g1_i1
Sequence
(Amino Acid)
IGRASYGFGGGSGCPAHKDRSCYLCHRQMLLCRVTLGRGFQLLSAMKMAHAPPGHHSVAG
RPSQGGLCFPEYVVYRGEQAYPEYLITYQIVSSESGPGEV
*(32 a.a.)

- SilkBase 1999-2023 -