SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG18304_5prime_partial:A_BomoMSG_c26094_g1_i2
Scaffold_idBomo_Chr26
NCBI non-redundant
(nr)		PREDICTED:_general_transcription_factor_IIH_subunit_3_[Papilio_polytes]
Ontology
GO:0000439 C transcription factor TFIIH core complex
GO:0003684 F damaged DNA binding
GO:0004672 F protein kinase activity
GO:0005634 C nucleus
GO:0005675 C transcription factor TFIIH holo complex
GO:0006281 P DNA repair
GO:0006289 P nucleotide-excision repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006412 P translation
GO:0006974 P cellular response to DNA damage stimulus
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0008135 F translation factor activity, RNA binding
GO:0008353 F RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0046872 F metal ion binding
GO:0070816 P phosphorylation of RNA polymerase II C-terminal domain
RNA-seq EntryA_BomoMSG_c26094_g1_i2
Sequence
(Amino Acid)
DRVATSRQQGCDITGGLYLKIPSLEGLLQYLLWVFLPEANERSKLVLPGRGRVDYRAACF
CHRELLTIGYVCSVCLSVFCKFSPICTTCHTVFKIGGPPIKPKKKKMKV
*(35 a.a.)

- SilkBase 1999-2023 -