SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG18099_5prime_partial:A_BomoMSG_c26040_g1_i5
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)
protein_neuralized_[Bombyx_mori]
Ontology
GO:0000209 P protein polyubiquitination
GO:0001964 P startle response
GO:0002121 P inter-male aggressive behavior
GO:0003677 F DNA binding
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0007219 P Notch signaling pathway
GO:0007275 P multicellular organism development
GO:0007398 P ectoderm development
GO:0007399 P nervous system development
GO:0007419 P ventral cord development
GO:0007422 P peripheral nervous system development
GO:0007423 P sensory organ development
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007498 P mesoderm development
GO:0007616 P long-term memory
GO:0008104 P protein localization
GO:0008270 F zinc ion binding
GO:0008356 P asymmetric cell division
GO:0008593 P regulation of Notch signaling pathway
GO:0016360 P sensory organ precursor cell fate determination
GO:0030154 P cell differentiation
GO:0030707 P ovarian follicle cell development
GO:0030718 P germ-line stem cell population maintenance
GO:0031987 P locomotion involved in locomotory behavior
GO:0042048 P olfactory behavior
GO:0045314 P regulation of compound eye photoreceptor development
GO:0045747 P positive regulation of Notch signaling pathway
GO:0046331 P lateral inhibition
GO:0046532 P regulation of photoreceptor cell differentiation
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0048749 P compound eye development
GO:0048854 P brain morphogenesis
GO:0051260 P protein homooligomerization
GO:0061630 F ubiquitin protein ligase activity
GO:1901981 F phosphatidylinositol phosphate binding
RNA-seq EntryA_BomoMSG_c26040_g1_i5
Sequence
(Amino Acid)
LPPQAGGHQANQQGLTLASAHYIEPIQATSQICLTGLQPLAQPSTCAQQFQSRPRNEVQC
SSTQNSTNEQVQMPNGHPEPLRLVERLPSTSRQHQPVYSVIGEGPTGAECSICYENPIDS
VLYMCGHMCMCYRCAVQQWRGKGGGQCPLCRAQIKDVIRTYKS
*(53 a.a.)

- SilkBase 1999-2023 -