SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1791_internal:A_BomoMSG_c8695_g1_i1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
ATP-binding_cassette_sub-family_G_member_8_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0007584 P response to nutrient
GO:0007588 P excretion
GO:0008152 P metabolic process
GO:0010949 P negative regulation of intestinal phytosterol absorption
GO:0015248 F sterol transporter activity
GO:0015914 P phospholipid transport
GO:0015918 P sterol transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0016887 F ATP hydrolysis activity
GO:0017127 F cholesterol transfer activity
GO:0030299 P intestinal cholesterol absorption
GO:0033344 P cholesterol efflux
GO:0042493 P response to xenobiotic stimulus
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0042632 P cholesterol homeostasis
GO:0043190 C ATP-binding cassette (ABC) transporter complex
GO:0043235 C receptor complex
GO:0045796 P negative regulation of intestinal cholesterol absorption
GO:0046982 F protein heterodimerization activity
GO:0055085 P transmembrane transport
GO:0055092 P sterol homeostasis
RNA-seq EntryA_BomoMSG_c8695_g1_i1
Sequence
(Amino Acid)
VRKKLSGDIVINGQPVASSTLRKVVAYVRNDTALCPTMSVEHTLRFHAALRKPRNTHSHV
KMGDRDRINLLIEELGLEQVRDTNVGRLTRSEIRRLNVACQLLLDMAILILDQPD
(37 a.a.)

- SilkBase 1999-2023 -