SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG17906_internal:A_BomoMSG_c25978_g1_i2
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
tyrosine-protein_phosphatase_10D_[Bombyx_mori]
Ontology
GO:0004721 F phosphoprotein phosphatase activity
GO:0004725 F protein tyrosine phosphatase activity
GO:0004728 F obsolete signal transducer, downstream of receptor, with protein tyrosine phosphatase activity
GO:0005001 F transmembrane receptor protein tyrosine phosphatase activity
GO:0005886 C plasma membrane
GO:0006470 P protein dephosphorylation
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007411 P axon guidance
GO:0007417 P central nervous system development
GO:0007424 P open tracheal system development
GO:0007616 P long-term memory
GO:0008045 P motor neuron axon guidance
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0023014 P signal transduction
GO:0030154 P cell differentiation
GO:0030424 C axon
GO:0035335 P peptidyl-tyrosine dephosphorylation
GO:0045177 C apical part of cell
RNA-seq EntryA_BomoMSG_c25978_g1_i2
Sequence
(Amino Acid)
DRKSELDLLPPDAASAEITNMTHGERYVIQLDTVSEPGDGGEVVESGQPLYAEHTIRPNP
VSEVAQLVGTRNVTLEWLNGSGRVDRYEVRWWPTDHAELAGLEGTDEDSARG
(36 a.a.)

- SilkBase 1999-2023 -