SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1784_internal:A_BomoMSG_c8671_g1_i1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)
histone_H4_transcription_factor_isoform_X2_[Bombyx_mori]
Ontology
GO:0000077 P DNA damage checkpoint signaling
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000083 P regulation of transcription involved in G1/S transition of mitotic cell cycle
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001701 P in utero embryonic development
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003713 F transcription coactivator activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0006281 P DNA repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0010468 P regulation of gene expression
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0015030 C Cajal body
GO:0019899 F enzyme binding
GO:0042393 F histone binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045184 P establishment of protein localization
GO:0045445 P myoblast differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoMSG_c8671_g1_i1
Sequence
(Amino Acid)
SPFKCTMCGIPCATEYLLNEHARQHVSAHVCALCDMTATSPAALAQHVRYRHLPRAPHHA
CTRCAYRAVTKNDLQKHLMIHDKKRNKKKSDRESDRDSDLSDNSIITTKKKKKKIPRKYA
CHMCPEDKMKVFARGNTLTSHLVKVHGAQWPYGHSRFRYQKSE
(53 a.a.)

- SilkBase 1999-2023 -