SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG17847_internal:A_BomoMSG_c25963_g1_i2
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)
lysine-specific_histone_demethylase_1A_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000784 C chromosome, telomeric region
GO:0000790 C chromatin
GO:0001085 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001701 P in utero embryonic development
GO:0002039 F p53 binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006482 P protein demethylation
GO:0007275 P multicellular organism development
GO:0008134 F transcription factor binding
GO:0008283 P cell population proliferation
GO:0010569 P regulation of double-strand break repair via homologous recombination
GO:0010725 P regulation of primitive erythrocyte differentiation
GO:0016491 F oxidoreductase activity
GO:0016568 P chromatin organization
GO:0019899 F enzyme binding
GO:0021983 P pituitary gland development
GO:0030374 F nuclear receptor coactivator activity
GO:0030851 P granulocyte differentiation
GO:0032091 P negative regulation of protein binding
GO:0032451 F demethylase activity
GO:0032452 F histone demethylase activity
GO:0032453 F histone H3-methyl-lysine-4 demethylase activity
GO:0032454 F histone H3-methyl-lysine-9 demethylase activity
GO:0033169 P histone H3-K9 demethylation
GO:0033184 P positive regulation of histone ubiquitination
GO:0034644 P cellular response to UV
GO:0034648 F obsolete histone demethylase activity (H3-dimethyl-K4 specific)
GO:0034720 P histone H3-K4 demethylation
GO:0042162 F telomeric DNA binding
GO:0043234 C protein-containing complex
GO:0043426 F MRF binding
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0043518 P negative regulation of DNA damage response, signal transduction by p53 class mediator
GO:0044212 F transcription cis-regulatory region binding
GO:0045648 P positive regulation of erythrocyte differentiation
GO:0045654 P positive regulation of megakaryocyte differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046886 P positive regulation of hormone biosynthetic process
GO:0050660 F flavin adenine dinucleotide binding
GO:0050681 F androgen receptor binding
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0051572 P negative regulation of histone H3-K4 methylation
GO:0051573 P negative regulation of histone H3-K9 methylation
GO:0055001 P muscle cell development
GO:0055114 P obsolete oxidation-reduction process
GO:0061752 F telomeric repeat-containing RNA binding
GO:0071480 P cellular response to gamma radiation
GO:1902166 P negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:1903758 P obsolete chromatin organization involved in negative regulation of transcription
GO:1903827 P regulation of protein localization
GO:1990391 C DNA repair complex
GO:2000179 P positive regulation of neural precursor cell proliferation
GO:2000648 P positive regulation of stem cell proliferation
RNA-seq EntryA_BomoMSG_c25963_g1_i2
Sequence
(Amino Acid)
LFRSVIVGRCIAVLKSIFGHAAVPQPKECIVTRWRADPFARGSYSFVAVGSSGTDYDLLA
APIPGTDGENRLFFAGEHTMRNYPATVHGAFLSGLREAGRLADMLLPLPDR
(36 a.a.)

- SilkBase 1999-2023 -