SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG17746_internal:A_BomoMSG_c25930_g1_i1
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)		DNA_replication_licensing_factor_Mcm5_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000278 P mitotic cell cycle
GO:0000785 C chromatin
GO:0003677 F DNA binding
GO:0003678 F DNA helicase activity
GO:0003682 F chromatin binding
GO:0003688 F DNA replication origin binding
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006260 P DNA replication
GO:0006268 P DNA unwinding involved in DNA replication
GO:0006270 P DNA replication initiation
GO:0007049 P cell cycle
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0030174 P regulation of DNA-dependent DNA replication initiation
GO:0042555 C MCM complex
GO:0043009 P chordate embryonic development
GO:0043066 P negative regulation of apoptotic process
RNA-seq EntryA_BomoMSG_c25930_g1_i1
Sequence
(Amino Acid)
CALPICCSVLAAANSVFGRWDDTKADDNIDFMPTILSRFDMIFIVKDEHDQNRDITLAKH
IISVHMGGESSERAAAAGELPLTTLRRYSAYCRARCGPR
(32 a.a.)

- SilkBase 1999-2023 -