SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1769_internal:A_BomoMSG_c8597_g1_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_chondroitin_sulfate_proteoglycan_4_[Bombyx_mori]
Ontology
GO:0000187 P obsolete activation of MAPK activity
GO:0001525 P angiogenesis
GO:0004871 F obsolete signal transducer activity
GO:0005576 C extracellular region
GO:0005796 C Golgi lumen
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005925 C focal adhesion
GO:0007165 P signal transduction
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007275 P multicellular organism development
GO:0008283 P cell population proliferation
GO:0008347 P glial cell migration
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0016477 P cell migration
GO:0019901 F protein kinase binding
GO:0030154 P cell differentiation
GO:0030203 P glycosaminoglycan metabolic process
GO:0030206 P chondroitin sulfate biosynthetic process
GO:0030207 P chondroitin sulfate catabolic process
GO:0030208 P dermatan sulfate biosynthetic process
GO:0031258 C lamellipodium membrane
GO:0035556 P intracellular signal transduction
GO:0042995 C cell projection
GO:0043202 C lysosomal lumen
GO:0048771 P tissue remodeling
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomoMSG_c8597_g1_i1
Sequence
(Amino Acid)
RDLSYTDADLDTKSSDIVYTVQRSPKDPPNGGIFRADNPSEQIATFTQDDINKNLVLFKH
QGKEYGKLAFWVSDGRYDVNGNLEIQASPPFIRMYPSNGSIMENGKAVVLTPNDMQ
(37 a.a.)

- SilkBase 1999-2023 -