SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1765_5prime_partial:A_BomoMSG_c8573_g1_i1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
protein_spaetzle_5_[Bombyx_mori]
Ontology
GO:0000578 P embryonic axis specification
GO:0005121 F Toll binding
GO:0005125 F cytokine activity
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0006952 P defense response
GO:0006955 P immune response
GO:0006965 P positive regulation of biosynthetic process of antibacterial peptides active against Gram-positive bacteria
GO:0006967 P positive regulation of antifungal peptide biosynthetic process
GO:0007275 P multicellular organism development
GO:0007310 P oocyte dorsal/ventral axis specification
GO:0007311 P maternal specification of dorsal/ventral axis, oocyte, germ-line encoded
GO:0008045 P motor neuron axon guidance
GO:0008063 P Toll signaling pathway
GO:0008083 F growth factor activity
GO:0008592 P regulation of Toll signaling pathway
GO:0009620 P response to fungus
GO:0009950 P dorsal/ventral axis specification
GO:0009953 P dorsal/ventral pattern formation
GO:0016015 F morphogen activity
GO:0019732 P antifungal humoral response
GO:0031334 P positive regulation of protein-containing complex assembly
GO:0031640 P killing of cells of another organism
GO:0042803 F protein homodimerization activity
GO:0043234 C protein-containing complex
GO:0045087 P innate immune response
GO:0050830 P defense response to Gram-positive bacterium
GO:0050832 P defense response to fungus
RNA-seq EntryA_BomoMSG_c8573_g1_i1
Sequence
(Amino Acid)
ALRIALGLASAETSAEGPRRQAVNAQELCSVRTEYITPRAALNNKGNWKYVVNMPDNMTQ
LVRAEICTSTTCSGLCTIPSGYTSRCEQKYIQKRLVALQSSGQNLYTDIFWIPSCCQCSI
IPNN
*(40 a.a.)

- SilkBase 1999-2023 -