SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG17630_5prime_partial:A_BomoMSG_c25891_g1_i2
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
nucleoporin_NUP53_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003697 F single-stranded DNA binding
GO:0005487 F structural constituent of nuclear pore
GO:0005515 F protein binding
GO:0005543 F phospholipid binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005643 C nuclear pore
GO:0005652 C nuclear lamina
GO:0005654 C nucleoplasm
GO:0005886 C plasma membrane
GO:0006355 P regulation of transcription, DNA-templated
GO:0006406 P mRNA export from nucleus
GO:0006409 P tRNA export from nucleus
GO:0006607 P NLS-bearing protein import into nucleus
GO:0006810 P transport
GO:0006999 P nuclear pore organization
GO:0007077 P mitotic nuclear membrane disassembly
GO:0010827 P regulation of glucose transmembrane transport
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016032 P viral process
GO:0016925 P protein sumoylation
GO:0019083 P viral transcription
GO:0031047 P gene silencing by RNA
GO:0031965 C nuclear membrane
GO:0043231 C intracellular membrane-bounded organelle
GO:0044613 C nuclear pore central transport channel
GO:0044615 C nuclear pore nuclear basket
GO:0045111 C intermediate filament cytoskeleton
GO:0051028 P mRNA transport
GO:0055085 P transmembrane transport
GO:0075733 P intracellular transport of virus
GO:1900034 P regulation of cellular response to heat
RNA-seq EntryA_BomoMSG_c25891_g1_i2
Sequence
(Amino Acid)
IPTSPNISYSTKPNGPPIEDLFDTIKSNEPSVNKSLYNDHSFLGYGNNMMLQNSYGNNID
LSVNNQSLSQWQDICQEQDEYWVTVFGFPPNAANTVLARFSNCGAILDKQYPTQGNWAHI
RYATRAEKERAMALSGRQVLPGVMVGVIECKEPPRISFTSPGIMSPERQTTGARSLCPTP
IPSAPVPQKSSGLISKALDYVLGW
*(67 a.a.)

- SilkBase 1999-2023 -