SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG17594_3prime_partial:A_BomoMSG_c25875_g1_i1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
hybrid_signal_transduction_histidine_kinase_I_[Bombyx_mori]
Ontology
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0005938 C cell cortex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0008284 P positive regulation of cell population proliferation
GO:0010468 P regulation of gene expression
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0010800 P positive regulation of peptidyl-threonine phosphorylation
GO:0010821 P regulation of mitochondrion organization
GO:0010971 P positive regulation of G2/M transition of mitotic cell cycle
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0045787 P positive regulation of cell cycle
GO:0048839 P inner ear development
GO:0050679 P positive regulation of epithelial cell proliferation
GO:0051301 P cell division
GO:0051881 P regulation of mitochondrial membrane potential
GO:0051897 P positive regulation of protein kinase B signaling
GO:0061418 P regulation of transcription from RNA polymerase II promoter in response to hypoxia
GO:0071500 P cellular response to nitrosative stress
GO:1901858 P regulation of mitochondrial DNA metabolic process
GO:1902882 P regulation of response to oxidative stress
GO:1904031 P positive regulation of cyclin-dependent protein kinase activity
GO:1904120 P positive regulation of otic vesicle morphogenesis
RNA-seq EntryA_BomoMSG_c25875_g1_i1
Sequence
(Amino Acid)
MSGRGGGGQRCQLILQRCLAIQLTKPGNAPDDFWMYDSGYLLFQSFLAANAKCWWAGALA
AATAELRYAGYVSPGVLLVAGAPRALETVRGAYSRSVLKPPPTYLICGLGDIEDCIVTPA
YQGQFTPLPEALCDCIMDLTSQGQAATLESIRTSLLSKFPSMQTPSQEVVYDTLAQLMQE
RKIYQTSRGFFIVTPERRRSRSRSSSRHPNSLDEECPSPRTILMSDQEALHQLYGEITTV
RDGAVTHQCVQTNLADVICGGNPNDKVLYGRPNKRRSASFPAPRSLDRRHSLRIFGSSSK
YLQRCASTRSLHHKHVNTTDSSSSTDYPPSVESASPKKVSLLSRLFRRSGRSKQTRAMST
FSAQFP
(121 a.a.)

- SilkBase 1999-2023 -