SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG17452_internal:A_BomoMSG_c25833_g1_i1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
AP-3_complex_subunit_delta_[Bombyx_mori]
Ontology
GO:0005770 C late endosome
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005795 C Golgi stack
GO:0005798 C Golgi-associated vesicle
GO:0005829 C cytosol
GO:0006726 P eye pigment biosynthetic process
GO:0006727 P ommochrome biosynthetic process
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006887 P exocytosis
GO:0006895 P Golgi to endosome transport
GO:0006897 P endocytosis
GO:0007040 P lysosome organization
GO:0007041 P lysosomal transport
GO:0007220 P Notch receptor processing
GO:0008055 P ocellus pigment biosynthetic process
GO:0008057 P eye pigment granule organization
GO:0008340 P determination of adult lifespan
GO:0008565 F obsolete protein transporter activity
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0030117 C membrane coat
GO:0030123 C AP-3 adaptor complex
GO:0030665 C clathrin-coated vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0046907 P intracellular transport
GO:0048072 P compound eye pigmentation
GO:0060967 P negative regulation of gene silencing by RNA
RNA-seq EntryA_BomoMSG_c25833_g1_i1
Sequence
(Amino Acid)
CALPISQLFDGELKPVAPKAQKKVPMPPDLNLDQWLSRDRWSSESSSSEGEGEGEEGGPM
FPAPHDARPTAQFTPEELDMLREARRQEQANNPHYLKDDSPRSYQQDDIPIAEIALEVPL
QIHTKRSDKYLMSRESSSKKKKEKRTTKKRKAKKQDKHSTDSESEEWERRDRKSV
(57 a.a.)

- SilkBase 1999-2023 -