SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG17429_5prime_partial:A_BomoMSG_c25828_g1_i1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
sodium/potassium-transporting_ATPase_subunit_beta-2_[Bombyx_mori]
Ontology
GO:0005391 F P-type sodium:potassium-exchanging transporter activity
GO:0005886 C plasma membrane
GO:0005890 C sodium:potassium-exchanging ATPase complex
GO:0005918 C septate junction
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006813 P potassium ion transport
GO:0006814 P sodium ion transport
GO:0007424 P open tracheal system development
GO:0007605 P sensory perception of sound
GO:0008324 F cation transmembrane transporter activity
GO:0010248 P establishment or maintenance of transmembrane electrochemical gradient
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019991 P septate junction assembly
GO:0030424 C axon
GO:0035151 P regulation of tube size, open tracheal system
GO:0035158 P regulation of tube diameter, open tracheal system
GO:0035159 P regulation of tube length, open tracheal system
GO:0060857 P establishment of glial blood-brain barrier
GO:0061343 P cell adhesion involved in heart morphogenesis
GO:0090662 P transmembrane transport
GO:0098655 P cation transmembrane transport
RNA-seq EntryA_BomoMSG_c25828_g1_i1
Sequence
(Amino Acid)
CSSDLFFDDLGSLPRDMPDDLVSYITNATANNRDYANMVWVSCQGETPADREMLGPISYL
PYPGFPGYFYPYENAEGYLSPLVAIHLQSPKTGIILNIECRAWAKNIRYDRREKLGVVHF
ELMLE
*(41 a.a.)

- SilkBase 1999-2023 -