SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG17427_3prime_partial:A_BomoMSG_c25827_g1_i2
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)
vesicle_transport_through_interaction_with_t-SNAREs_homolog_1A_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000149 F SNARE binding
GO:0005484 F SNAP receptor activity
GO:0005515 F protein binding
GO:0005768 C endosome
GO:0005776 C autophagosome
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006623 P protein targeting to vacuole
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006891 P intra-Golgi vesicle-mediated transport
GO:0006896 P Golgi to vacuole transport
GO:0006914 P autophagy
GO:0008021 C synaptic vesicle
GO:0012507 C ER to Golgi transport vesicle membrane
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016023 C cytoplasmic vesicle
GO:0016192 P vesicle-mediated transport
GO:0030136 C clathrin-coated vesicle
GO:0031201 C SNARE complex
GO:0031410 C cytoplasmic vesicle
GO:0031902 C late endosome membrane
GO:0032588 C trans-Golgi network membrane
GO:0042147 P retrograde transport, endosome to Golgi
GO:0043025 C neuronal cell body
GO:0044306 C neuron projection terminus
GO:0048280 P vesicle fusion with Golgi apparatus
GO:0048471 C perinuclear region of cytoplasm
GO:0050882 P voluntary musculoskeletal movement
GO:0090161 P Golgi ribbon formation
RNA-seq EntryA_BomoMSG_c25827_g1_i2
Sequence
(Amino Acid)
MATLVQSYEQQYSVLTADITAKIGRLKNGTAENREQLSREIQSNFEEANDLLEQLELEAR
GPRVAAYRAELQRVKQQFKTTLGTNGHLVGEVSESEDWGAGDERRQLLDNSERLERGGRV
LSEGYRVLLETEQVGAAVLQDLSVQRETIQRSRARLRETDEELDRSWRVAA
(56 a.a.)

- SilkBase 1999-2023 -