SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG17271_internal:A_BomoMSG_c25775_g1_i3
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_circadian_locomoter_output_cycles_protein_kaput_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003053 P circadian regulation of heart rate
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007622 P rhythmic behavior
GO:0007623 P circadian rhythm
GO:0008062 P eclosion rhythm
GO:0008134 F transcription factor binding
GO:0009266 P response to temperature stimulus
GO:0009649 P entrainment of circadian clock
GO:0032922 P circadian regulation of gene expression
GO:0043066 P negative regulation of apoptotic process
GO:0045187 P regulation of circadian sleep/wake cycle, sleep
GO:0045475 P locomotor rhythm
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0048148 P behavioral response to cocaine
GO:0048511 P rhythmic process
RNA-seq EntryA_BomoMSG_c25775_g1_i3
Sequence
(Amino Acid)
DRKSVAHDIQEDWKPTFLSNEEFTYLVLEALEGFVMVFSASGRIYYVSESIKSLLGYNPT
EILNKSIFDLTFEEDRPNLYNILQNTNTPNPKGRGSMKLP
(32 a.a.)

- SilkBase 1999-2023 -