SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG17190_5prime_partial:A_BomoMSG_c25747_g1_i1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		dual_specificity_protein_phosphatase_19_[Bombyx_mori]
Ontology
GO:0004721 F phosphoprotein phosphatase activity
GO:0004725 F protein tyrosine phosphatase activity
GO:0004860 F protein kinase inhibitor activity
GO:0005078 F MAP-kinase scaffold activity
GO:0005515 F protein binding
GO:0006469 P negative regulation of protein kinase activity
GO:0006470 P protein dephosphorylation
GO:0008138 F protein tyrosine/serine/threonine phosphatase activity
GO:0008579 F JUN kinase phosphatase activity
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0030295 F protein kinase activator activity
GO:0031435 F mitogen-activated protein kinase kinase kinase binding
GO:0032147 P activation of protein kinase activity
GO:0035335 P peptidyl-tyrosine dephosphorylation
GO:0043410 P positive regulation of MAPK cascade
GO:0043507 P positive regulation of JUN kinase activity
GO:0043508 P negative regulation of JUN kinase activity
GO:0045860 P positive regulation of protein kinase activity
GO:0046329 P negative regulation of JNK cascade
GO:0046330 P positive regulation of JNK cascade
RNA-seq EntryA_BomoMSG_c25747_g1_i1
Sequence
(Amino Acid)
CALPICFADQLQKQKMKLKGTDTIITNADGQRYIESKTNEKIVLSPNAYGFVVDNKPDNT
PALITEHLYVGSQDCTAENVLVQHDIRHVLSLGVKVPLKIDYKYIDCLDLPEIDVRPLLG
KSLPYLRDCVLLKQNVLVHCNAGVSRTSTVAIGYLMQYENMSFDEAHKLVKTKRPAVRPN
DGFRKQLEQLKPGELI
*(64 a.a.)

- SilkBase 1999-2023 -