SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1712_internal:A_BomoMSG_c8121_g1_i1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)
crossover_junction_endonuclease_MUS81_[Bombyx_mori]
Ontology
GO:0000711 P meiotic DNA repair synthesis
GO:0000712 P resolution of meiotic recombination intermediates
GO:0000724 P double-strand break repair via homologous recombination
GO:0000737 P DNA catabolic process, endonucleolytic
GO:0003677 F DNA binding
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0005634 C nucleus
GO:0005739 C mitochondrion
GO:0006259 P DNA metabolic process
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007131 P reciprocal meiotic recombination
GO:0008821 F crossover junction endodeoxyribonuclease activity
GO:0016787 F hydrolase activity
GO:0031573 P mitotic intra-S DNA damage checkpoint signaling
GO:0033314 P mitotic DNA replication checkpoint signaling
GO:0046872 F metal ion binding
GO:0048476 C Holliday junction resolvase complex
GO:0051321 P meiotic cell cycle
RNA-seq EntryA_BomoMSG_c8121_g1_i1
Sequence
(Amino Acid)
YKPVYRSGSYAILIALLDNFKENQIKPLLTKEQLIERAQPHCEESFVRPKPDTYYTAWSS
MSKLTTKGLVNKTVKKKTYYNLTENGIKLASDLLKESIRIPTLN
(33 a.a.)

- SilkBase 1999-2023 -