SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG16996_internal:A_BomoMSG_c25693_g1_i2
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		HMG_box-containing_protein_4_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000790 C chromatin
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001525 P angiogenesis
GO:0001568 P blood vessel development
GO:0001570 P vasculogenesis
GO:0001701 P in utero embryonic development
GO:0001942 P hair follicle development
GO:0001944 P vasculature development
GO:0001945 P lymph vessel development
GO:0001946 P lymphangiogenesis
GO:0001947 P heart looping
GO:0003151 P outflow tract morphogenesis
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007507 P heart development
GO:0022405 P hair cycle process
GO:0035050 P embryonic heart tube development
GO:0042789 P mRNA transcription by RNA polymerase II
GO:0043534 P blood vessel endothelial cell migration
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0044798 C transcription regulator complex
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0048469 P cell maturation
GO:0048866 P stem cell fate specification
GO:0060214 P endocardium formation
GO:0060836 P lymphatic endothelial cell differentiation
GO:0060956 P endocardial cell differentiation
GO:0061028 P establishment of endothelial barrier
GO:0072091 P regulation of stem cell proliferation
RNA-seq EntryA_BomoMSG_c25693_g1_i2
Sequence
(Amino Acid)
VCSSDLARTPANSLYMMEKNSKKKLIVKDGRVIGRAKAQRKDKGKTRITAYMMWAKEARN
ELLKKHPDMDFSAISKRLGEMWSNVNYNERYLWKRKAKRFAIQKEQNNQVINKIISNPSV
RPANPGPGRPSVGRPPRTPA
(45 a.a.)

- SilkBase 1999-2023 -