SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG16964_3prime_partial:A_BomoMSG_c25673_g1_i1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)
adenomatous_polyposis_coli_protein_isoform_X1_[Bombyx_mori]
Ontology
GO:0000281 P mitotic cytokinesis
GO:0000776 C kinetochore
GO:0001708 P cell fate specification
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005881 C cytoplasmic microtubule
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0005913 C adherens junction
GO:0005938 C cell cortex
GO:0006461 P protein-containing complex assembly
GO:0006974 P cellular response to DNA damage stimulus
GO:0007026 P negative regulation of microtubule depolymerization
GO:0007050 P regulation of cell cycle
GO:0007163 P establishment or maintenance of cell polarity
GO:0007389 P pattern specification process
GO:0008013 F beta-catenin binding
GO:0008017 F microtubule binding
GO:0008283 P cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0016020 C membrane
GO:0016055 P Wnt signaling pathway
GO:0016477 P cell migration
GO:0019887 F protein kinase regulator activity
GO:0030027 C lamellipodium
GO:0030054 C cell junction
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0030425 C dendrite
GO:0030426 C growth cone
GO:0030877 C beta-catenin destruction complex
GO:0031016 P pancreas development
GO:0031175 P neuron projection development
GO:0031965 C nuclear membrane
GO:0032403 F protein-containing complex binding
GO:0032587 C ruffle membrane
GO:0032886 P regulation of microtubule-based process
GO:0042493 P response to xenobiotic stimulus
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043065 P positive regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0044295 C axonal growth cone
GO:0044306 C neuron projection terminus
GO:0045202 C synapse
GO:0045295 F gamma-catenin binding
GO:0045595 P regulation of cell differentiation
GO:0045732 P positive regulation of protein catabolic process
GO:0045736 P negative regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0051010 F microtubule plus-end binding
GO:0070852 C cell body fiber
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0097305 P response to alcohol
GO:1990090 P cellular response to nerve growth factor stimulus
GO:2000211 P regulation of glutamate metabolic process
RNA-seq EntryA_BomoMSG_c25673_g1_i1
Sequence
(Amino Acid)
MVDPWSSMDSSNSPLTDSGPSASEDCTPSTSSEPSRGRLSASSPISPDTRRLPDPKGTNP
KISKPPFKAADKARSRDLTLELETLEHDTHRRRPHFLDEDYQPPSKSNIECRIPKPHFLD
HSPSPDEFDERSDITNPNFLDDDVDGDDSHPQKKAGALPKKPQKLTTSYSAHEDRHRTSY
RSTLQYRLESAARSSERDKRASQLYRGTWPGERDVWTGQDSSSIRSFSSSGSTDGPRTSS
SLENKMECVCSLISLLSLSPENNADLSGPLLDMSRSVESCIAMRQAGCIPLLVQLIHSKV
SRETRDRAAKALRNIIHTQTDDKAGRREARVWRLLEQVREYCYVLEDVVEAKKEGKKAIE
DDATKHPSQSVAALMKLSFDEEHRHVVCQLGGLQALAALVSGDQTAHGSRTDDNTCLTMR
KYAGMTLTNLTFGDGNNKSLLCSFKDFMLALVEQLESPNDDMRQVTAAVLRNLSWRADTN
SKQVLREVGAVKGLTKAAMTCQKEATLKSVLSALWNLTAHCSMNKVALCSVDGALGFLVD
MLSYNSPTKTLAIVENAGG
(185 a.a.)

- SilkBase 1999-2023 -