SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG16944_5prime_partial:A_BomoMSG_c25663_g1_i3
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)
serpin_5_[Bombyx_mandarina]
Ontology
GO:0004867 F serine-type endopeptidase inhibitor activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005539 F glycosaminoglycan binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005829 C cytosol
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007566 P embryo implantation
GO:0007596 P blood coagulation
GO:0008201 F heparin binding
GO:0008285 P negative regulation of cell population proliferation
GO:0009314 P response to radiation
GO:0009611 P response to wounding
GO:0010466 P negative regulation of peptidase activity
GO:0010544 P negative regulation of platelet activation
GO:0010757 P negative regulation of plasminogen activation
GO:0010766 P negative regulation of sodium ion transport
GO:0010951 P negative regulation of endopeptidase activity
GO:0010955 P negative regulation of protein processing
GO:0010976 P positive regulation of neuron projection development
GO:0014067 P negative regulation of phosphatidylinositol 3-kinase signaling
GO:0016020 C membrane
GO:0021683 P cerebellar granular layer morphogenesis
GO:0030154 P cell differentiation
GO:0030195 P negative regulation of blood coagulation
GO:0030308 P negative regulation of cell growth
GO:0030334 P regulation of cell migration
GO:0030414 F peptidase inhibitor activity
GO:0031012 C extracellular matrix
GO:0031091 C platelet alpha granule
GO:0031232 C extrinsic component of external side of plasma membrane
GO:0031594 C neuromuscular junction
GO:0032940 P secretion by cell
GO:0033363 P secretory granule organization
GO:0042177 P negative regulation of protein catabolic process
GO:0042628 P mating plug formation
GO:0043025 C neuronal cell body
GO:0045861 P negative regulation of proteolysis
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0048505 P regulation of timing of cell differentiation
GO:0048711 P positive regulation of astrocyte differentiation
GO:0050974 P detection of mechanical stimulus involved in sensory perception
GO:0051966 P regulation of synaptic transmission, glutamatergic
GO:0060291 P long-term synaptic potentiation
GO:0060384 P innervation
GO:0061108 P seminal vesicle epithelium development
GO:0061110 P dense core granule biogenesis
GO:0090331 P negative regulation of platelet aggregation
GO:1903561 C extracellular vesicle
RNA-seq EntryA_BomoMSG_c25663_g1_i3
Sequence
(Amino Acid)
CSSDLVKLPRFQISTNVVLNKPLNDMGVYDIFQPDLANFQRITKENIFVSAIVHKADIEV
TESGTVASASTVATLTDRISAPAFHANRPFVYFVMEKTTTTVIFSGIYSKPTVY
*(37 a.a.)

- SilkBase 1999-2023 -