SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG16669_internal:A_BomoMSG_c25578_g2_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
uncharacterized_protein_F21D5.5_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000718 P nucleotide-excision repair, DNA damage removal
GO:0003684 F damaged DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003824 F catalytic activity
GO:0004519 F endonuclease activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0006261 P DNA-dependent DNA replication
GO:0006281 P DNA repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0006979 P response to oxidative stress
GO:0008152 P metabolic process
GO:0009314 P response to radiation
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016311 P dephosphorylation
GO:0016740 F transferase activity
GO:0016787 F hydrolase activity
GO:0017076 F purine nucleotide binding
GO:0019201 F nucleoside monophosphate kinase activity
GO:0032212 P positive regulation of telomere maintenance via telomerase
GO:0042769 P obsolete DNA damage response, detection of DNA damage
GO:0046403 F polynucleotide 3'-phosphatase activity
GO:0046404 F polydeoxyribonucleotide 5'-hydroxyl-kinase activity
GO:0046939 P nucleotide phosphorylation
GO:0051973 P positive regulation of telomerase activity
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
GO:0098504 P obsolete DNA 3' dephosphorylation involved in DNA repair
GO:0098506 P polynucleotide 3' dephosphorylation
GO:1904355 P positive regulation of telomere capping
RNA-seq EntryA_BomoMSG_c25578_g2_i1
Sequence
(Amino Acid)
NQAPIGNGRVKIEDFKKKIESIVQKLNVPVQAYIATGKGIYRKPRIGMWMTLTEKKNDGV
KVDMNQSFYCGDAAGRVANWAPGKKKDHSLADKLFAENLELKFYTPEQFFLGDRKSV
(38 a.a.)

- SilkBase 1999-2023 -